About

I tend to lean toward the more unusual things in life, i like to think of it as broadening my horizons

This blog is dedicated to a love for all that is macabre, edgy and beautiful in the world:

Fashion/Glamor
Sex
Art
Cinema

and everything else in between

Search keywords

Following

morbidfashionholybatintelligenceandaloadedpistoljdkeen617shondseesmortisiahearts-on-auctiondyaphanumdaxxxxvelvetforestfuckyeahtattooshoodoothatvoodoozodiacsocietyidreamofaworldofcouturefuckyeahladygagadoimakeyouhornyxunyakhymeirafashion-underworldthats-so-memecatclockszheuglyducklingvintagevandalizmornamentedbeingcoveredwithblackserenitysyntheticdollrossoporporafeedmywoundsimdaphnewithnoleafsnorflowersnikkilipsticksnakedchokedeyesjackiee123youbringthatsmarthaircutsleepisoveratedmidnightdesiresfatalfashiondailydiamondsorcusroseliver-alonepeachz90undertheblanketshautemacabrepusheennekomiminikkithesilentknightmiss-vesper-lyndvintagesoniakamenawataminefedrabloodglitterlusttheeblackbellesfuckyeahthierrymuglerakiresregdorohcruelfateorgasmic-couturecelestialistazmatiqvalentinovampastonishedeyescrowsandrosespumpkinpsychosishellomynameisfontwinterisalloveryounothingpersonalukallthingsdarkandbeautifulurbangothikvelvedsparksininfinitythief-lordgothsandpunksfuckyeahgothicfashionstarrfrommarsyyanninsomebodyelsesskyfuckyeahbeautyaddictkittygrungefashionmusicmagikrationaldrugsdarknessinfashionsex-lust-lovelucialuminosaitsjustsexbrittanyjosiefuckyeahstolenbabieswiththemoonbeamsdavid-cervantesfashioninhistoryfuckyeahgothsgettingdowninchitownmylegsfeellikerocketssilverstudsandsparklesalicedoesntlivehereabstruseorthodoxfuckyeahgarethpugh

Liked posts

See more stuff I like

Follow me

Follow on Tumblr

Follow on Twitter

Get the RSS

↓ Navigate ↓

HAR?

themed by Cherrie H.

She Toyed with Her Beads Jadedly

Source: seexxxy

About

(via velvetforest)

23rd Feb 2012 (4:21 pm) - Reblogged from my mind runs...

68 Notes →
#cathedral#architecture#gothic architecture

Notes

  1. ghost-pepper reblogged this from hangugsarang
  2. tearsofariver reblogged this from ipreferprettythings
  3. ipreferprettythings reblogged this from nonjews
  4. zora-domain reblogged this from nonjews
  5. nonjews reblogged this from seexxxy
  6. hangugsarang reblogged this from divelikehell
  7. violisto reblogged this from pedmonsters
  8. pedmonsters reblogged this from exhile-paradoxum
  9. benjamoni reblogged this from arctic-faults
  10. medisoldier reblogged this from ironmanofmischief
  11. ironmanofmischief reblogged this from annilylf
  12. annilylf reblogged this from lacarmina
  13. yaviil reblogged this from astrospark
  14. imthejuggernaut-bitch reblogged this from lacarmina
  15. warawawayukionna reblogged this from lacarmina
  16. skinnyschizophrenia reblogged this from velvetforest
  17. hotpinknightmare reblogged this from thenekozawa
  18. tsdie reblogged this from astrospark
  19. kituo reblogged this from lovegungun
  20. viral-dysphoria reblogged this from astrospark
  21. astrospark reblogged this from velvetforest
  22. thenekozawa reblogged this from lovegungun
  23. gorgasmic reblogged this from theartofdecay
  24. lovegungun reblogged this from seexxxy
  25. modestmermaid reblogged this from silencethroughthenoise
  26. ur-high-ness-bb reblogged this from lacarmina
  27. s-a-b-r-i-n-a-s reblogged this from prixdebeaute
  28. andreamarquez reblogged this from jotasrevenge
  29. arctic-faults reblogged this from seexxxy
  30. lacarmina reblogged this from tetsu-anon
  31. theartofdecay reblogged this from prixdebeaute
  32. prixdebeaute reblogged this from velvetforest
  33. velvetforest reblogged this from seexxxy